PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca40708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TCP
Protein Properties Length: 170aa    MW: 18952.9 Da    PI: 8.4701
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca40708.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP107.81.7e-33108169162
         TCP   1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikel 62 
                 a+gkkdrhsk++T++g+RdRRvRl a++a++f+d+qd+LG+d++sk+++WL+++ak ai+el
  Dca40708.1 108 ATGKKDRHSKVCTAKGPRDRRVRLAAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKSAIDEL 169
                 589*********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-30109169IPR005333Transcription factor, TCP
PROSITE profilePS5136932.963111169IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
DDDVNLSGQQ QQQQQRRYDE SYENNHFYVQ HESGHEFGEV YTGIETDNLG PISDKKRSSS  60
SMAGECTEGV RRKASMSGNA ACVSSRAALR RAGVGEIVEV QGGHILRATG KKDRHSKVCT  120
AKGPRDRRVR LAAHTAIQFY DVQDRLGYDR PSKAVDWLIK KAKSAIDELD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00009PBMTransfer from 929286Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133163.15e-49hypothetical protein PHAVU_011G156900g
TrEMBLA0A0K9RU334e-59A0A0K9RU33_SPIOL; Uncharacterized protein
STRINGGLYMA06G34330.12e-47(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.33e-47TCP family protein